C16orf89 polyclonal antibody
  • C16orf89 polyclonal antibody

C16orf89 polyclonal antibody

Ref: AB-PAB20664
C16orf89 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf89.
Información adicional
Size 100 uL
Gene Name C16orf89
Gene Alias MGC45438
Gene Description chromosome 16 open reading frame 89
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDASLVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf89.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146556
Iso type IgG

Enviar uma mensagem


C16orf89 polyclonal antibody

C16orf89 polyclonal antibody