LRRC70 polyclonal antibody
  • LRRC70 polyclonal antibody

LRRC70 polyclonal antibody

Ref: AB-PAB20656
LRRC70 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC70.
Información adicional
Size 100 uL
Gene Name LRRC70
Gene Alias SLRN
Gene Description leucine rich repeat containing 70
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC70.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100130733
Iso type IgG

Enviar uma mensagem


LRRC70 polyclonal antibody

LRRC70 polyclonal antibody