RELL1 polyclonal antibody
  • RELL1 polyclonal antibody

RELL1 polyclonal antibody

Ref: AB-PAB20653
RELL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RELL1.
Información adicional
Size 100 uL
Gene Name RELL1
Gene Alias FLJ21778|MGC50583
Gene Description RELT-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq NEANADVLKAMVADNSLYDPESPVTPSTPGSPPVSPGPLSPGGTPGKHVCGHHLHTVGGVVERDVCHRCRHKRWHFIKPTNKSRESRPRRQGEVTVLSVGRFRVTKVEHKSNQKERRSLMSVSGAETVNGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RELL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 768211
Iso type IgG

Enviar uma mensagem


RELL1 polyclonal antibody

RELL1 polyclonal antibody