LEPREL1 polyclonal antibody
  • LEPREL1 polyclonal antibody

LEPREL1 polyclonal antibody

Ref: AB-PAB20651
LEPREL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LEPREL1.
Información adicional
Size 100 uL
Gene Name LEPREL1
Gene Alias FLJ10718|MLAT4|P3H2
Gene Description leprecan-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHMESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTECRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVLVCQHECV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LEPREL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55214
Iso type IgG

Enviar uma mensagem


LEPREL1 polyclonal antibody

LEPREL1 polyclonal antibody