DDX26B polyclonal antibody
  • DDX26B polyclonal antibody

DDX26B polyclonal antibody

Ref: AB-PAB20648
DDX26B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DDX26B.
Información adicional
Size 100 uL
Gene Name DDX26B
Gene Alias DKFZp686G0470|FLJ41215|MGC88298
Gene Description DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNLDCGLSYSVISYLKKLSQQTKLESERILASVGKKPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEITGETALRLTELNTKEFAGFQIGLLNKDLKPQTYRNAYDIPRRGLLDQLTRMRSNLLKTH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DDX26B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203522
Iso type IgG

Enviar uma mensagem


DDX26B polyclonal antibody

DDX26B polyclonal antibody