View larger
Rabbit polyclonal antibody raised against recombinant DDX26B.
AB-PAB20648
New product
DDX26B polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | DDX26B |
| Gene Alias | DKFZp686G0470|FLJ41215|MGC88298 |
| Gene Description | DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | DNLDCGLSYSVISYLKKLSQQTKLESERILASVGKKPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEITGETALRLTELNTKEFAGFQIGLLNKDLKPQTYRNAYDIPRRGLLDQLTRMRSNLLKTH |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human DDX26B. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 203522 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against recombinant DDX26B.