SYDE1 polyclonal antibody
  • SYDE1 polyclonal antibody

SYDE1 polyclonal antibody

Ref: AB-PAB20647
SYDE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYDE1.
Información adicional
Size 100 uL
Gene Name SYDE1
Gene Alias 7h3|FLJ13511
Gene Description synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILDLERELSKQINV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYDE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85360
Iso type IgG

Enviar uma mensagem


SYDE1 polyclonal antibody

SYDE1 polyclonal antibody