CLCC1 polyclonal antibody
  • CLCC1 polyclonal antibody

CLCC1 polyclonal antibody

Ref: AB-PAB20646
CLCC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CLCC1.
Información adicional
Size 100 uL
Gene Name CLCC1
Gene Alias KIAA0761|MCLC
Gene Description chloride channel CLIC-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq HDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CLCC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23155
Iso type IgG

Enviar uma mensagem


CLCC1 polyclonal antibody

CLCC1 polyclonal antibody