GPR158 polyclonal antibody
  • GPR158 polyclonal antibody

GPR158 polyclonal antibody

Ref: AB-PAB20643
GPR158 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GPR158.
Información adicional
Size 100 uL
Gene Name GPR158
Gene Alias FLJ37801|KIAA1136|RP11-59G22.1
Gene Description G protein-coupled receptor 158
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQNSNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVPSESKVQKHVSIVASEMEKNPTFSLKEKSHHKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GPR158.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57512
Iso type IgG

Enviar uma mensagem


GPR158 polyclonal antibody

GPR158 polyclonal antibody