PNMAL1 polyclonal antibody
  • PNMAL1 polyclonal antibody

PNMAL1 polyclonal antibody

Ref: AB-PAB20641
PNMAL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PNMAL1.
Información adicional
Size 100 uL
Gene Name PNMAL1
Gene Alias FLJ10781
Gene Description PNMA-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPKGINSNSTANLEDPEVGDAESMAISEPIKGSRKPCVNKEELALKKPMAKCAWKGPREPPQDARAEAESPGGASESDQDGGHESPPKKKAVAWVSAKNPAPMRKKKKVSLGPVSYVLVDSEDGRKKPVMP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PNMAL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55228
Iso type IgG

Enviar uma mensagem


PNMAL1 polyclonal antibody

PNMAL1 polyclonal antibody