TMEM130 polyclonal antibody
  • TMEM130 polyclonal antibody

TMEM130 polyclonal antibody

Ref: AB-PAB20639
TMEM130 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM130.
Información adicional
Size 100 uL
Gene Name TMEM130
Gene Alias DKFZp761L1417|FLJ42643
Gene Description transmembrane protein 130
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NATQQKDMVENPEPPSGVRCCCQMCCGPFLLETPSEYLEIVRENHGLLPPLYKSVK
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM130.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222865
Iso type IgG

Enviar uma mensagem


TMEM130 polyclonal antibody

TMEM130 polyclonal antibody