ANKRD22 polyclonal antibody
  • ANKRD22 polyclonal antibody

ANKRD22 polyclonal antibody

Ref: AB-PAB20638
ANKRD22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKRD22.
Información adicional
Size 100 uL
Gene Name ANKRD22
Gene Alias MGC22805
Gene Description ankyrin repeat domain 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKRD22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118932
Iso type IgG

Enviar uma mensagem


ANKRD22 polyclonal antibody

ANKRD22 polyclonal antibody