C17orf80 polyclonal antibody
  • C17orf80 polyclonal antibody

C17orf80 polyclonal antibody

Ref: AB-PAB20636
C17orf80 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C17orf80.
Información adicional
Size 100 uL
Gene Name C17orf80
Gene Alias FLJ20721|HLC-8|MIG3
Gene Description chromosome 17 open reading frame 80
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C17orf80.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55028
Iso type IgG

Enviar uma mensagem


C17orf80 polyclonal antibody

C17orf80 polyclonal antibody