ATP7A polyclonal antibody
  • ATP7A polyclonal antibody

ATP7A polyclonal antibody

Ref: AB-PAB20632
ATP7A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP7A.
Información adicional
Size 100 uL
Gene Name ATP7A
Gene Alias FLJ17790|MK|MNK
Gene Description ATPase, Cu++ transporting, alpha polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELC
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATP7A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 538
Iso type IgG

Enviar uma mensagem


ATP7A polyclonal antibody

ATP7A polyclonal antibody