SCRG1 polyclonal antibody
  • SCRG1 polyclonal antibody

SCRG1 polyclonal antibody

Ref: AB-PAB20631
SCRG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCRG1.
Información adicional
Size 100 uL
Gene Name SCRG1
Gene Alias MGC26468|SCRG-1
Gene Description scrapie responsive protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCRG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11341
Iso type IgG

Enviar uma mensagem


SCRG1 polyclonal antibody

SCRG1 polyclonal antibody