FBN2 polyclonal antibody
  • FBN2 polyclonal antibody

FBN2 polyclonal antibody

Ref: AB-PAB20628
FBN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBN2.
Información adicional
Size 100 uL
Gene Name FBN2
Gene Alias CCA|DA9
Gene Description fibrillin 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDGLPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPIITGLTILNQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2201
Iso type IgG

Enviar uma mensagem


FBN2 polyclonal antibody

FBN2 polyclonal antibody