ANKK1 polyclonal antibody
  • ANKK1 polyclonal antibody

ANKK1 polyclonal antibody

Ref: AB-PAB20626
ANKK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ANKK1.
Información adicional
Size 100 uL
Gene Name ANKK1
Gene Alias PKK2
Gene Description ankyrin repeat and kinase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ANKK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255239
Iso type IgG

Enviar uma mensagem


ANKK1 polyclonal antibody

ANKK1 polyclonal antibody