PLD3 polyclonal antibody
  • PLD3 polyclonal antibody

PLD3 polyclonal antibody

Ref: AB-PAB20624
PLD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLD3.
Información adicional
Size 100 uL
Gene Name PLD3
Gene Alias HU-K4
Gene Description phospholipase D family, member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23646
Iso type IgG

Enviar uma mensagem


PLD3 polyclonal antibody

PLD3 polyclonal antibody