DPEP1 polyclonal antibody
  • DPEP1 polyclonal antibody

DPEP1 polyclonal antibody

Ref: AB-PAB20623
DPEP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPEP1.
Información adicional
Size 100 uL
Gene Name DPEP1
Gene Alias MBD1|MDP|RDP
Gene Description dipeptidase 1 (renal)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DPEP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1800
Iso type IgG

Enviar uma mensagem


DPEP1 polyclonal antibody

DPEP1 polyclonal antibody