UGCGL1 polyclonal antibody
  • UGCGL1 polyclonal antibody

UGCGL1 polyclonal antibody

Ref: AB-PAB20620
UGCGL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UGCGL1.
Información adicional
Size 100 uL
Gene Name UGCGL1
Gene Alias FLJ23671|FLJ23796|HUGT1
Gene Description UDP-glucose ceramide glucosyltransferase-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq DFILSHAVYCRDVLKLKKGQRAVISNGRIIGPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UGCGL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56886
Iso type IgG

Enviar uma mensagem


UGCGL1 polyclonal antibody

UGCGL1 polyclonal antibody