CYP2W1 polyclonal antibody
  • CYP2W1 polyclonal antibody

CYP2W1 polyclonal antibody

Ref: AB-PAB20619
CYP2W1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYP2W1.
Información adicional
Size 100 uL
Gene Name CYP2W1
Gene Alias MGC34287
Gene Description cytochrome P450, family 2, subfamily W, polypeptide 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQELKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CYP2W1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54905
Iso type IgG

Enviar uma mensagem


CYP2W1 polyclonal antibody

CYP2W1 polyclonal antibody