SCNN1A polyclonal antibody
  • SCNN1A polyclonal antibody

SCNN1A polyclonal antibody

Ref: AB-PAB20617
SCNN1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCNN1A.
Información adicional
Size 100 uL
Gene Name SCNN1A
Gene Alias ENaCa|ENaCalpha|FLJ21883|SCNEA|SCNN1
Gene Description sodium channel, nonvoltage-gated 1 alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCNN1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6337
Iso type IgG

Enviar uma mensagem


SCNN1A polyclonal antibody

SCNN1A polyclonal antibody