SPTBN1 polyclonal antibody
  • SPTBN1 polyclonal antibody

SPTBN1 polyclonal antibody

Ref: AB-PAB20613
SPTBN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPTBN1.
Información adicional
Size 100 uL
Gene Name SPTBN1
Gene Alias ELF|SPTB2|betaSpII
Gene Description spectrin, beta, non-erythrocytic 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPTBN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6711
Iso type IgG

Enviar uma mensagem


SPTBN1 polyclonal antibody

SPTBN1 polyclonal antibody