GALNT8 polyclonal antibody
  • GALNT8 polyclonal antibody

GALNT8 polyclonal antibody

Ref: AB-PAB20609
GALNT8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNT8.
Información adicional
Size 100 uL
Gene Name GALNT8
Gene Alias GALNAC-T8
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 8 (GalNAc-T8)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNT8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26290
Iso type IgG

Enviar uma mensagem


GALNT8 polyclonal antibody

GALNT8 polyclonal antibody