BTN3A1 polyclonal antibody
  • BTN3A1 polyclonal antibody

BTN3A1 polyclonal antibody

Ref: AB-PAB20602
BTN3A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BTN3A1.
Información adicional
Size 100 uL
Gene Name BTN3A1
Gene Alias BT3.1|BTF5|CD277|MGC141880
Gene Description butyrophilin, subfamily 3, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BTN3A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11119
Iso type IgG

Enviar uma mensagem


BTN3A1 polyclonal antibody

BTN3A1 polyclonal antibody