MRPL52 polyclonal antibody
  • MRPL52 polyclonal antibody

MRPL52 polyclonal antibody

Ref: AB-PAB20595
MRPL52 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL52.
Información adicional
Size 100 uL
Gene Name MRPL52
Gene Alias -
Gene Description mitochondrial ribosomal protein L52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq QWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL52.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 122704
Iso type IgG

Enviar uma mensagem


MRPL52 polyclonal antibody

MRPL52 polyclonal antibody