GRAMD1C polyclonal antibody
  • GRAMD1C polyclonal antibody

GRAMD1C polyclonal antibody

Ref: AB-PAB20594
GRAMD1C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRAMD1C.
Información adicional
Size 100 uL
Gene Name GRAMD1C
Gene Alias DKFZp434C0328|DKFZp686K06117|FLJ35862|FLJ40464
Gene Description GRAM domain containing 1C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRAMD1C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54762
Iso type IgG

Enviar uma mensagem


GRAMD1C polyclonal antibody

GRAMD1C polyclonal antibody