SCD polyclonal antibody
  • SCD polyclonal antibody

SCD polyclonal antibody

Ref: AB-PAB20587
SCD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SCD.
Información adicional
Size 100 uL
Gene Name SCD
Gene Alias FADS5|MSTP008|SCD1
Gene Description stearoyl-CoA desaturase (delta-9-desaturase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SCD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6319
Iso type IgG

Enviar uma mensagem


SCD polyclonal antibody

SCD polyclonal antibody