TMBIM1 polyclonal antibody
  • TMBIM1 polyclonal antibody

TMBIM1 polyclonal antibody

Ref: AB-PAB20584
TMBIM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMBIM1.
Información adicional
Size 100 uL
Gene Name TMBIM1
Gene Alias MST100|MSTP100|PP1201|RECS1
Gene Description transmembrane BAX inhibitor motif containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMBIM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64114
Iso type IgG

Enviar uma mensagem


TMBIM1 polyclonal antibody

TMBIM1 polyclonal antibody