PARP14 polyclonal antibody
  • PARP14 polyclonal antibody

PARP14 polyclonal antibody

Ref: AB-PAB20581
PARP14 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARP14.
Información adicional
Size 100 uL
Gene Name PARP14
Gene Alias BAL2|KIAA1268
Gene Description poly (ADP-ribose) polymerase family, member 14
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARP14.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54625
Iso type IgG

Enviar uma mensagem


PARP14 polyclonal antibody

PARP14 polyclonal antibody