B3GAT2 polyclonal antibody
  • B3GAT2 polyclonal antibody

B3GAT2 polyclonal antibody

Ref: AB-PAB20580
B3GAT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant B3GAT2.
Información adicional
Size 100 uL
Gene Name B3GAT2
Gene Alias GLCATS|GlcAT-S|KIAA1963|MGC138535
Gene Description beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PVGLVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human B3GAT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135152
Iso type IgG

Enviar uma mensagem


B3GAT2 polyclonal antibody

B3GAT2 polyclonal antibody