THRAP3 polyclonal antibody
  • THRAP3 polyclonal antibody

THRAP3 polyclonal antibody

Ref: AB-PAB20578
THRAP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THRAP3.
Información adicional
Size 100 uL
Gene Name THRAP3
Gene Alias FLJ22082|MGC133082|MGC133083|TRAP150
Gene Description thyroid hormone receptor associated protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ETEEREESTTGFDKSRLGTKDFVGPSERGGGRARGTFQFRARGRGWGRGNYSGNNNNNSNNDFQKRNREEEWDPEYTPKSKKYYLHDDREGEGSDKWVSRGRGRGAFPRGRGRFMFRKSSTSPKWAHDKFS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THRAP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9967
Iso type IgG

Enviar uma mensagem


THRAP3 polyclonal antibody

THRAP3 polyclonal antibody