GCS1 polyclonal antibody
  • GCS1 polyclonal antibody

GCS1 polyclonal antibody

Ref: AB-PAB20575
GCS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GCS1.
Información adicional
Size 100 uL
Gene Name GCS1
Gene Alias -
Gene Description glucosidase I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LESHAEGFRERFEKTFQLKEKGLSSGEQVLGQAALSGLLGGIGYFYGQGLVLPDIGVEGSEQKVDPALFPPVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRWDPSLTREALGHWLGLLNADGWIG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GCS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7841
Iso type IgG

Enviar uma mensagem


GCS1 polyclonal antibody

GCS1 polyclonal antibody