DNAJC4 polyclonal antibody
  • DNAJC4 polyclonal antibody

DNAJC4 polyclonal antibody

Ref: AB-PAB20571
DNAJC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC4.
Información adicional
Size 100 uL
Gene Name DNAJC4
Gene Alias DANJC4|HSPF2|MCG18|MGC19482|MGC57189|MGC71863
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3338
Iso type IgG

Enviar uma mensagem


DNAJC4 polyclonal antibody

DNAJC4 polyclonal antibody