SLC2A8 polyclonal antibody
  • SLC2A8 polyclonal antibody

SLC2A8 polyclonal antibody

Ref: AB-PAB20570
SLC2A8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC2A8.
Información adicional
Size 100 uL
Gene Name SLC2A8
Gene Alias GLUT8|GLUTX1
Gene Description solute carrier family 2 (facilitated glucose transporter), member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC2A8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 29988
Iso type IgG

Enviar uma mensagem


SLC2A8 polyclonal antibody

SLC2A8 polyclonal antibody