RRBP1 polyclonal antibody
  • RRBP1 polyclonal antibody

RRBP1 polyclonal antibody

Ref: AB-PAB20568
RRBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RRBP1.
Información adicional
Size 100 uL
Gene Name RRBP1
Gene Alias DKFZp586A1420|ES/130|ES130|FLJ36146|MGC157720|MGC157721|hES
Gene Description ribosome binding protein 1 homolog 180kDa (dog)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RRBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6238
Iso type IgG

Enviar uma mensagem


RRBP1 polyclonal antibody

RRBP1 polyclonal antibody