SLC6A18 polyclonal antibody
  • SLC6A18 polyclonal antibody

SLC6A18 polyclonal antibody

Ref: AB-PAB20564
SLC6A18 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC6A18.
Información adicional
Size 100 uL
Gene Name SLC6A18
Gene Alias FLJ31236|Xtrp2
Gene Description solute carrier family 6, member 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC6A18.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 348932
Iso type IgG

Enviar uma mensagem


SLC6A18 polyclonal antibody

SLC6A18 polyclonal antibody