WBP5 polyclonal antibody
  • WBP5 polyclonal antibody

WBP5 polyclonal antibody

Ref: AB-PAB20561
WBP5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WBP5.
Información adicional
Size 100 uL
Gene Name WBP5
Gene Alias DKFZp313K1940|TCEAL9
Gene Description WW domain binding protein 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WBP5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51186
Iso type IgG

Enviar uma mensagem


WBP5 polyclonal antibody

WBP5 polyclonal antibody