FAM159B polyclonal antibody
  • FAM159B polyclonal antibody

FAM159B polyclonal antibody

Ref: AB-PAB20559
FAM159B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM159B.
Información adicional
Size 100 uL
Gene Name FAM159B
Gene Alias -
Gene Description family with sequence similarity 159, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM159B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100132916
Iso type IgG

Enviar uma mensagem


FAM159B polyclonal antibody

FAM159B polyclonal antibody