CCDC51 polyclonal antibody
  • CCDC51 polyclonal antibody

CCDC51 polyclonal antibody

Ref: AB-PAB20552
CCDC51 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC51.
Información adicional
Size 100 uL
Gene Name CCDC51
Gene Alias FLJ12436
Gene Description coiled-coil domain containing 51
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RLQELKALLLEAQKGPVSLQEAIREQASSYSRQQRDLHNLMVDLRGLVHAAGPGQDSGSQAGSPPTRDRDVDVLSAALKEQLSHSRQVHSCLEGLREQLDGLEKTCSQMAGVVQLVKSAAHPGLVEPADGAMPSFLLEQGSMILAL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC51.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79714
Iso type IgG

Enviar uma mensagem


CCDC51 polyclonal antibody

CCDC51 polyclonal antibody