SDK1 polyclonal antibody
  • SDK1 polyclonal antibody

SDK1 polyclonal antibody

Ref: AB-PAB20550
SDK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDK1.
Información adicional
Size 100 uL
Gene Name SDK1
Gene Alias FLJ31425
Gene Description sidekick homolog 1, cell adhesion molecule (chicken)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ICNKYNGAVLTESVSLKEKSADASESEATDSDYEDALPKHSFVNHYMSDPTYYNSWKRRAQGRAPAPHRYEAVAGSEAGAQLHPVITTQSAGGVYTPAGPGARTPLTGFSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221935
Iso type IgG

Enviar uma mensagem


SDK1 polyclonal antibody

SDK1 polyclonal antibody