C1RL polyclonal antibody
  • C1RL polyclonal antibody

C1RL polyclonal antibody

Ref: AB-PAB20548
C1RL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1RL.
Información adicional
Size 100 uL
Gene Name C1RL
Gene Alias C1RL1|C1RLP|C1r-LP|CLSPa
Gene Description complement component 1, r subcomponent-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Form Liquid
Recomended Dilution Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1RL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51279
Iso type IgG

Enviar uma mensagem


C1RL polyclonal antibody

C1RL polyclonal antibody