HSPA12A polyclonal antibody
  • HSPA12A polyclonal antibody

HSPA12A polyclonal antibody

Ref: AB-PAB20545
HSPA12A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HSPA12A.
Información adicional
Size 100 uL
Gene Name HSPA12A
Gene Alias FLJ13874|KIAA0417
Gene Description heat shock 70kDa protein 12A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KLLVKDGTRWCTDVFDKFISADQSVALGELVKRSYTPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGTLRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAIDIATSKSVKVGID
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HSPA12A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 259217
Iso type IgG

Enviar uma mensagem


HSPA12A polyclonal antibody

HSPA12A polyclonal antibody