FAM134A polyclonal antibody
  • FAM134A polyclonal antibody

FAM134A polyclonal antibody

Ref: AB-PAB20542
FAM134A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM134A.
Información adicional
Size 100 uL
Gene Name FAM134A
Gene Alias C2orf17|DKFZp686C2379|MGC3035
Gene Description family with sequence similarity 134, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGGFSVSRATTPQLTDVSEDLDQQSLPSEPEETLSRDLGEGEEGELAPPEDLLGRPQALSRQALDSEEEEEDVAAKETLLRLSSPLHFVNTHFNGAGSPPDGVKCSPGGPVETLSPETVSGGLTALPGTLSPPLCLVGSDPA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM134A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79137
Iso type IgG

Enviar uma mensagem


FAM134A polyclonal antibody

FAM134A polyclonal antibody