LRRN1 polyclonal antibody
  • LRRN1 polyclonal antibody

LRRN1 polyclonal antibody

Ref: AB-PAB20532
LRRN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRN1.
Información adicional
Size 100 uL
Gene Name LRRN1
Gene Alias FIGLER3|KIAA1497|NLRR-1
Gene Description leucine rich repeat neuronal 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSNKTNIRFMEPLSMFCAMPPEYKGHQVKEVLIQDSSEQCLPMISHDSFPNRLNVDIGTTVFLDCRAMAEPEPEIYWVTPIGNKITVETLSDKYKLSSEGTLEISNIQIEDSGRYTCVAQNVQGAD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57633
Iso type IgG

Enviar uma mensagem


LRRN1 polyclonal antibody

LRRN1 polyclonal antibody