MANEA polyclonal antibody
  • MANEA polyclonal antibody

MANEA polyclonal antibody

Ref: AB-PAB20530
MANEA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MANEA.
Información adicional
Size 100 uL
Gene Name MANEA
Gene Alias DKFZp686D20120|ENDO|FLJ12838|hEndo
Gene Description mannosidase, endo-alpha
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MANEA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79694
Iso type IgG

Enviar uma mensagem


MANEA polyclonal antibody

MANEA polyclonal antibody