SYT12 polyclonal antibody
  • SYT12 polyclonal antibody

SYT12 polyclonal antibody

Ref: AB-PAB20524
SYT12 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYT12.
Información adicional
Size 100 uL
Gene Name SYT12
Gene Alias SRG1|SYT11
Gene Description synaptotagmin XII
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LLSLSYLPTAERLTVVVVKAKNLIWTNDKTTADPFVKVYLLQDGRKMSKKKTAVKRDDPNPVFNEAMIFSVPAIVLQDLSLRVTVAESSSDGRGDNVGHVIIGPSASGMGTTHWNQMLATLRRPVSMWHAV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYT12.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 91683
Iso type IgG

Enviar uma mensagem


SYT12 polyclonal antibody

SYT12 polyclonal antibody