ZMYM6 polyclonal antibody
  • ZMYM6 polyclonal antibody

ZMYM6 polyclonal antibody

Ref: AB-PAB20523
ZMYM6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZMYM6.
Información adicional
Size 100 uL
Gene Name ZMYM6
Gene Alias MYM|ZNF198L4|ZNF258
Gene Description zinc finger, MYM-type 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCSKYK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZMYM6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9204
Iso type IgG

Enviar uma mensagem


ZMYM6 polyclonal antibody

ZMYM6 polyclonal antibody