LOC203547 polyclonal antibody
  • LOC203547 polyclonal antibody

LOC203547 polyclonal antibody

Ref: AB-PAB20520
LOC203547 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC203547.
Información adicional
Size 100 uL
Gene Name LOC203547
Gene Alias MGC125514|MGC125516|MGC131652
Gene Description hypothetical protein LOC203547
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC203547.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 203547
Iso type IgG

Enviar uma mensagem


LOC203547 polyclonal antibody

LOC203547 polyclonal antibody