SHROOM4 polyclonal antibody
  • SHROOM4 polyclonal antibody

SHROOM4 polyclonal antibody

Ref: AB-PAB20500
SHROOM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SHROOM4.
Información adicional
Size 100 uL
Gene Name SHROOM4
Gene Alias KIAA1202
Gene Description shroom family member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GSCALNPEEVLEQPQPLSFGHLEGSRQGSQSVPAEQESFALHSSDFLPPIRGHLGSQPEQAQPPCYYGIGGLWRTSGQEATESAKQEFQHFSPPSGAPGIPTSYSAYYNISVAKAELLNKLKDQPEMAEIG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SHROOM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57477
Iso type IgG

Enviar uma mensagem


SHROOM4 polyclonal antibody

SHROOM4 polyclonal antibody