NFKBIZ polyclonal antibody
  • NFKBIZ polyclonal antibody

NFKBIZ polyclonal antibody

Ref: AB-PAB20499
NFKBIZ polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NFKBIZ.
Información adicional
Size 100 uL
Gene Name NFKBIZ
Gene Alias FLJ30225|FLJ34463|IKBZ|INAP|MAIL
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NFKBIZ.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64332
Iso type IgG

Enviar uma mensagem


NFKBIZ polyclonal antibody

NFKBIZ polyclonal antibody